RetrogeneDB ID: | retro_sscr_876 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:86663536..86663748(-) | ||
| Located in intron of: | ENSSSCG00000003642 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL30 | ||
| Ensembl ID: | ENSSSCG00000006081 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L30 [Source:HGNC Symbol;Acc:10333] |
| Percent Identity: | 75.34 % |
| Parental protein coverage: | 62.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | KLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDP-GDSDIIRSMPEQT |
| KLVILA.NC.ALR.SEIEYY..LAKTGVH.YSG..IEL..AC.KY.RVC.LA.IDP..DS..IRSMPEQT | |
| Retrocopy | KLVILASNCLALRESEIEYYSVLAKTGVHGYSGSHIELDIACRKYCRVCILALIDP<SDSH-IRSMPEQT |
| Parental | GEK |
| GEK | |
| Retrocopy | GEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 253 .65 RPM |
| SRP014902_testis | 0 .14 RPM | 430 .85 RPM |
| SRP018288_heart | 0 .00 RPM | 290 .46 RPM |
| SRP018288_kidney | 0 .00 RPM | 324 .48 RPM |
| SRP018288_liver | 0 .00 RPM | 330 .37 RPM |
| SRP018288_lung | 0 .00 RPM | 87 .98 RPM |
| SRP018856_adipose | 0 .00 RPM | 1248 .10 RPM |
| SRP035408_brain | 0 .10 RPM | 97 .38 RPM |
| SRP035408_liver | 0 .00 RPM | 85 .43 RPM |