RetrogeneDB ID: | retro_sscr_779 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 4:55440273..55440659(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000025751 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.08 % |
| Parental protein coverage: | 79.14 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 1 |
| Parental | SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIAT |
| SEPIRVLVTGA.G.IAYSLL..IGNGSVFGK.QPIIL.L.D..PMMG.LDGVLME.QDC..PLLKD.I.T | |
| Retrocopy | SEPIRVLVTGATG*IAYSLL*CIGNGSVFGKHQPIILELVDFMPMMGILDGVLMEQQDCTHPLLKDIITT |
| Parental | DKEEIAFKDLDVAILVGSMPRRDGMERKD-LLKANVKIFKCQGAALDKYAKKSVKVYRGG |
| D..EIAFK.LDV.IL...MP....M..KD.LLKAN.KIFKCQGA.L.KYAKKSV..Y.GG | |
| Retrocopy | DRKEIAFKSLDVIILMSFMP*TYWMQTKD<LLKANMKIFKCQGATLEKYAKKSV*GYCGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 13 .67 RPM |
| SRP014902_testis | 0 .00 RPM | 26 .31 RPM |
| SRP018288_heart | 0 .00 RPM | 161 .06 RPM |
| SRP018288_kidney | 0 .00 RPM | 85 .90 RPM |
| SRP018288_liver | 0 .00 RPM | 21 .11 RPM |
| SRP018288_lung | 0 .00 RPM | 9 .06 RPM |
| SRP018856_adipose | 0 .00 RPM | 80 .77 RPM |
| SRP035408_brain | 0 .00 RPM | 71 .52 RPM |
| SRP035408_liver | 0 .00 RPM | 40 .22 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019295 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007281 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007018 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013329 | 2 retrocopies | |
| Homo sapiens | ENSG00000014641 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007085 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000016504 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006163 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009823 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000014487 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012373 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011974 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000007690 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025751 | 1 retrocopy |
retro_sscr_779 ,
|
| Tarsius syrichta | ENSTSYG00000001215 | 2 retrocopies |