RetrogeneDB ID: | retro_sscr_690 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 2:157480939..157481332(-) | ||
| Located in intron of: | ENSSSCG00000014436 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MOSPD1 | ||
| Ensembl ID: | ENSSSCG00000012686 | ||
| Aliases: | None | ||
| Description: | motile sperm domain containing 1 [Source:HGNC Symbol;Acc:25235] |
| Percent Identity: | 74.05 % |
| Parental protein coverage: | 61.5 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | LTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKA |
| LTL..P..FALK.KVL..TPNK.V.VDAAGAV.PQCCVD....HRDVRSC...V.DKFRLQVS.QSQ.KA | |
| Retrocopy | LTLHSPHQFALKVKVLGATPNKRVAVDAAGAVTPQCCVDVATCHRDVRSCPRRVMDKFRLQVSGQSQGKA |
| Parental | LGRKEVVATLLPSAKEQQKEEEEKRIKEHLTESLFFEQSFQPENRTVSSGPSLLTVFLGVV |
| .GRKEVVATLL..A.EQQKEEE.K.IKEHL..SLF.EQSFQPE.RT.SSGP..LTVFLG.V | |
| Retrocopy | SGRKEVVATLLSWAQEQQKEEEAKGIKEHLSASLFCEQSFQPEGRTASSGPRPLTVFLGGV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .27 RPM | 29 .47 RPM |
| SRP014902_testis | 0 .14 RPM | 15 .98 RPM |
| SRP018288_heart | 0 .08 RPM | 10 .22 RPM |
| SRP018288_kidney | 0 .00 RPM | 33 .00 RPM |
| SRP018288_liver | 0 .16 RPM | 57 .57 RPM |
| SRP018288_lung | 0 .00 RPM | 12 .02 RPM |
| SRP018856_adipose | 0 .00 RPM | 19 .06 RPM |
| SRP035408_brain | 0 .13 RPM | 10 .35 RPM |
| SRP035408_liver | 0 .00 RPM | 80 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001304 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007386 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013117 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000022505 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000015178 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000023074 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005739 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000011544 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012686 | 1 retrocopy |
retro_sscr_690 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000008152 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006102 | 1 retrocopy |