RetrogeneDB ID: | retro_dnov_2660 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_95736:131..508(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MOSPD1 | ||
| Ensembl ID: | ENSDNOG00000013117 | ||
| Aliases: | None | ||
| Description: | motile sperm domain containing 1 [Source:HGNC Symbol;Acc:25235] |
| Percent Identity: | 72.52 % |
| Parental protein coverage: | 60.75 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | THKQVLTLYNPYEFVLKFKVLCTTPNKYVVVDAAGAVKPQC-CVDIVIRHRDVRSCHYGVIDKFRLQVSE |
| .HKQVL.LYNPYEFVL.FKVLCTT.NKYVVV.AAG...PQC.CV.IVIRHRD..S.HYG..DKF.L.V.E | |
| Retrocopy | SHKQVLALYNPYEFVLMFKVLCTTANKYVVVPAAGTAMPQC<CVYIVIRHRDAPSRHYG--DKFCLHVYE |
| Parental | QSQRKALGRKEVVATLLPSAKEQQKEEEGKRIKEHLTESLFFEQSFQPGKNRTVSSGPSLL |
| QS.RKALGR..VVATLLP.AKE.QKEEEG..IKE.LTESL..EQSF.P..N..VSSG...L | |
| Retrocopy | QS*RKALGR-NVVATLLPFAKEHQKEEEGEQIKEYLTESLYSEQSFRP-ENTPVSSGHNFL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 4 .28 RPM |
| SRP012922_cerebellum | 0 .41 RPM | 4 .81 RPM |
| SRP012922_heart | 0 .00 RPM | 11 .14 RPM |
| SRP012922_kidney | 0 .00 RPM | 2 .19 RPM |
| SRP012922_liver | 0 .15 RPM | 7 .28 RPM |
| SRP012922_lung | 0 .00 RPM | 3 .51 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 9 .17 RPM |
| SRP012922_spleen | 0 .00 RPM | 2 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001304 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007386 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013117 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000022505 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000015178 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000023074 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005739 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000011544 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012686 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008152 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006102 | 1 retrocopy |