RetrogeneDB ID: | retro_sscr_516 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 15:157198652..157198957(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BET1 | ||
| Ensembl ID: | ENSSSCG00000015325 | ||
| Aliases: | None | ||
| Description: | Bet1 golgi vesicular membrane trafficking protein [Source:HGNC Symbol;Acc:14562] |
| Percent Identity: | 58.72 % |
| Parental protein coverage: | 90.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MRRAGLGEGVPPGNYGNYGYPN-SGYSACEEENERLTESLRNKVTAIKSLSIEIGHEVKHQNKLLAEMDS |
| MR.AGL.E.V.P...GNYGYP...GYSA..EEN.RLTE.L..KVTAI..LSI....EVKHQNKLLAEMDS | |
| Retrocopy | MRCAGLDERVAP---GNYGYPM<GGYSA-NEENKRLTENLKSKVTAITFLSIATDYEVKHQNKLLAEMDS |
| Parental | QF-DSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFV |
| Q......GFLGKT..KLKILS.......L.....F..F. | |
| Retrocopy | QWIHVLPGFLGKTTRKLKILS--GRSSMLLFSLSFLSFI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 4 .38 RPM |
| SRP014902_testis | 0 .00 RPM | 8 .35 RPM |
| SRP018288_heart | 0 .00 RPM | 8 .02 RPM |
| SRP018288_kidney | 0 .00 RPM | 17 .34 RPM |
| SRP018288_liver | 0 .00 RPM | 52 .29 RPM |
| SRP018288_lung | 0 .00 RPM | 14 .05 RPM |
| SRP018856_adipose | 0 .00 RPM | 9 .73 RPM |
| SRP035408_brain | 0 .00 RPM | 6 .26 RPM |
| SRP035408_liver | 0 .00 RPM | 11 .77 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003424 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001276 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013720 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001012 | 3 retrocopies | |
| Homo sapiens | ENSG00000105829 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002176 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000587 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000007 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015441 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017029 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004536 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000019408 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011008 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015325 | 2 retrocopies |
retro_sscr_455, retro_sscr_516 ,
|
| Tupaia belangeri | ENSTBEG00000000765 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009729 | 2 retrocopies |