RetrogeneDB ID: | retro_ptro_2584 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 7:151909253..151909608(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BET1 | ||
| Ensembl ID: | ENSPTRG00000019408 | ||
| Aliases: | None | ||
| Description: | Bet1 golgi vesicular membrane trafficking protein [Source:HGNC Symbol;Acc:14562] |
| Percent Identity: | 83.19 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQ |
| M..AGLGEG.PP.N.GN.GYAN.GYSACEEENE.LTESLRSKVTAIKS.SIEIGHEVKTQNKLLA.MDSQ | |
| Retrocopy | MKHAGLGEGIPPDNSGNDGYANNGYSACEEENETLTESLRSKVTAIKSFSIEIGHEVKTQNKLLAAMDSQ |
| Parental | FDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFV-FFIIYWIIKLR |
| FDSTTGFLGKT.GKL.ILS..SQTKLLC..MLF.LFV.FF.IYWI.KLR | |
| Retrocopy | FDSTTGFLGKTVGKLEILSIRSQTKLLCSTMLFHLFV>FFVIYWISKLR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 4 .56 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 5 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .99 RPM |
| SRP007412_kidney | 0 .10 RPM | 12 .66 RPM |
| SRP007412_liver | 0 .03 RPM | 9 .43 RPM |
| SRP007412_testis | 0 .00 RPM | 6 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3809 |
| Gorilla gorilla | retro_ggor_2560 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003424 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001276 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013720 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001012 | 3 retrocopies | |
| Homo sapiens | ENSG00000105829 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002176 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000587 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000007 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015441 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017029 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004536 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000019408 | 1 retrocopy |
retro_ptro_2584 ,
|
| Rattus norvegicus | ENSRNOG00000011008 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015325 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000765 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009729 | 2 retrocopies |