RetrogeneDB ID: | retro_ggor_2560 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 7:149197922..149198211(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BET1 | ||
| Ensembl ID: | ENSGGOG00000002176 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.6 % |
| Parental protein coverage: | 72.73 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGS |
| .GYSA.EEENE.LTESLRSKVTAIKS.SIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKL.ILS..S | |
| Retrocopy | NGYSAYEEENETLTESLRSKVTAIKSFSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLEILSIRS |
| Parental | QTKLLCYMMLFSLFV-FFIIYWIIKLR |
| QTKLLC..MLF.LFV.FF.IYWI.KLR | |
| Retrocopy | QTKLLCSTMLFHLFV>FFVIYWISKLR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .50 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 4 .06 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .25 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .75 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .76 RPM |
| SRP007412_testis | 0 .00 RPM | 9 .01 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3809 |
| Pan troglodytes | retro_ptro_2584 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003424 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001276 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013720 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001012 | 3 retrocopies | |
| Homo sapiens | ENSG00000105829 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002176 | 1 retrocopy |
retro_ggor_2560 ,
|
| Loxodonta africana | ENSLAFG00000000587 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000007 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015441 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017029 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004536 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000019408 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011008 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015325 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000765 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009729 | 2 retrocopies |