RetrogeneDB ID: | retro_sscr_394 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 13:178709597..178709932(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | EIF1 | ||
| Ensembl ID: | ENSSSCG00000017430 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 1 [Source:HGNC Symbol;Acc:3249] |
| Percent Identity: | 91.23 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKK-KFAC |
| MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTT.QG.ADDYDKK..VKAFKK..FA. | |
| Retrocopy | MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTGQGLADDYDKKP-VKAFKK<EFAY |
| Parental | NGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF |
| NGTVIEHPEYGEVIQLQ.DQ.KNICQFLVEIGLAKDDQLK.HGF | |
| Retrocopy | NGTVIEHPEYGEVIQLQSDQHKNICQFLVEIGLAKDDQLKIHGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 660 .07 RPM |
| SRP014902_testis | 0 .42 RPM | 240 .74 RPM |
| SRP018288_heart | 0 .10 RPM | 396 .68 RPM |
| SRP018288_kidney | 0 .39 RPM | 339 .55 RPM |
| SRP018288_liver | 0 .48 RPM | 294 .55 RPM |
| SRP018288_lung | 0 .00 RPM | 138 .89 RPM |
| SRP018856_adipose | 0 .08 RPM | 379 .54 RPM |
| SRP035408_brain | 0 .10 RPM | 170 .46 RPM |
| SRP035408_liver | 0 .06 RPM | 109 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005620 | 9 retrocopies | |
| Canis familiaris | ENSCAFG00000029584 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012120 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000014350 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007856 | 11 retrocopies | |
| Dipodomys ordii | ENSDORG00000013853 | 4 retrocopies | |
| Homo sapiens | ENSG00000173812 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027201 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000015360 | 6 retrocopies | |
| Myotis lucifugus | ENSMLUG00000005077 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031577 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000029667 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000033765 | 15 retrocopies | |
| Sorex araneus | ENSSARG00000006287 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000005729 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017430 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000017135 | 3 retrocopies |