RetrogeneDB ID: | retro_dnov_2209 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_55762:674..912(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | EIF1 | ||
| Ensembl ID: | ENSDNOG00000007856 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 1 [Source:HGNC Symbol;Acc:3249] |
| Percent Identity: | 71.6 % |
| Parental protein coverage: | 70.8 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | RIQQRNGRKTLTTVQGIADDYDK-KKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGL |
| RIQQRNGR.TL.T.QGIADDYDK......A.KK..AC.GTVIEHPE.GEVIQLQGDQ..NIC.FL.E.GL | |
| Retrocopy | RIQQRNGRETLITIQGIADDYDK>RLVKMAKKK-LACSGTVIEHPEDGEVIQLQGDQCNNICKFLAETGL |
| Parental | AKDDQLKVHGF |
| AK.D..KV.GF | |
| Retrocopy | AKGDHVKVNGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 129 .71 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 132 .66 RPM |
| SRP012922_heart | 0 .00 RPM | 152 .68 RPM |
| SRP012922_kidney | 0 .00 RPM | 162 .36 RPM |
| SRP012922_liver | 0 .00 RPM | 167 .66 RPM |
| SRP012922_lung | 0 .00 RPM | 212 .90 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 339 .42 RPM |
| SRP012922_spleen | 0 .11 RPM | 177 .87 RPM |