RetrogeneDB ID: | retro_ggor_318 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:161877301..161877631(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000026683 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | EIF1 | ||
| Ensembl ID: | ENSGGOG00000027201 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 94.59 % |
| Parental protein coverage: | 98.23 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGT |
| AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKT.TTVQGIADDYDKKKLVKAF.K.FACNGT | |
| Retrocopy | AIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTFTTVQGIADDYDKKKLVKAF-KNFACNGT |
| Parental | VIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF |
| VIEHPEYGEVIQ.QGDQ.KNICQFLVE.GLAKDDQLKVHGF | |
| Retrocopy | VIEHPEYGEVIQPQGDQCKNICQFLVELGLAKDDQLKVHGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 186 .59 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 217 .44 RPM |
| SRP007412_heart | 0 .00 RPM | 123 .30 RPM |
| SRP007412_kidney | 0 .04 RPM | 324 .00 RPM |
| SRP007412_liver | 0 .08 RPM | 286 .99 RPM |
| SRP007412_testis | 0 .00 RPM | 324 .16 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_271 |
| Pan troglodytes | retro_ptro_227 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005620 | 9 retrocopies | |
| Canis familiaris | ENSCAFG00000029584 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012120 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000014350 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007856 | 11 retrocopies | |
| Dipodomys ordii | ENSDORG00000013853 | 4 retrocopies | |
| Homo sapiens | ENSG00000173812 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027201 | 2 retrocopies |
retro_ggor_1251, retro_ggor_318 ,
|
| Macropus eugenii | ENSMEUG00000015360 | 6 retrocopies | |
| Myotis lucifugus | ENSMLUG00000005077 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031577 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000029667 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000033765 | 15 retrocopies | |
| Sorex araneus | ENSSARG00000006287 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000005729 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017430 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000017135 | 3 retrocopies |