RetrogeneDB ID: | retro_sscr_384 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 13:147867708..147867975(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SLIRP | ||
| Ensembl ID: | ENSSSCG00000028167 | ||
| Aliases: | None | ||
| Description: | SRA stem-loop interacting RNA binding protein [Source:HGNC Symbol;Acc:20495] |
| Percent Identity: | 68.89 % |
| Parental protein coverage: | 88.24 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | FVRKIPWTAASNELREHFAQFGHIRKCIVPFDKETGFHRGMGWIQFSSEEELHNVLQQENHVIDGVKLHV |
| FVRK.P.T.AS.ELREHFAQ.G....C.VPF.KE..F.RG..WIQ..S.E.L...LQQENHVI.GVKLHV | |
| Retrocopy | FVRKNP*TLASSELREHFAQLGYVIQCTVPFHKEIDFPRGTAWIQCPSGE-LPTALQQENHVINGVKLHV |
| Parental | QAQKRKALQGDQTSDEEKDF |
| QAQ..KALQ.DQTSD.EKDF | |
| Retrocopy | QAQNAKALQEDQTSDKEKDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 13 .80 RPM |
| SRP014902_testis | 0 .00 RPM | 13 .15 RPM |
| SRP018288_heart | 0 .00 RPM | 19 .30 RPM |
| SRP018288_kidney | 0 .00 RPM | 12 .51 RPM |
| SRP018288_liver | 0 .00 RPM | 9 .59 RPM |
| SRP018288_lung | 0 .00 RPM | 2 .95 RPM |
| SRP018856_adipose | 0 .00 RPM | 33 .43 RPM |
| SRP035408_brain | 0 .00 RPM | 2 .25 RPM |
| SRP035408_liver | 0 .00 RPM | 2 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000008135 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
| Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
| Homo sapiens | ENSG00000119705 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006030 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |