RetrogeneDB ID: | retro_cpor_1388 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_8:6318582..6318830(+) | ||
| Located in intron of: | ENSCPOG00000005683 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SLIRP | ||
| Ensembl ID: | ENSCPOG00000001500 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.48 % |
| Parental protein coverage: | 76.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MAASIARGAPALRTVVNRPVAFVRKIPWTAASNELREYFAQF-GHIRKCTVPFDRRTGFHRGLGWVQFSS |
| ......RG.....T.VNRPVAFVR.IPWT.A.NEL..YFAQ..GHI.KC.VP.D..TGFHRGL.W.QFSS | |
| Retrocopy | VVVAVVRGDTVVHTSVNRPVAFVRNIPWTTAPNELTGYFAQL<GHICKCHVPVDKETGFHRGLDWFQFSS |
| Parental | EEELQNAIQYENHI |
| EEELQNA.Q.ENH. | |
| Retrocopy | EEELQNATQHENHV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .06 RPM | 3 .74 RPM |
| SRP017611_kidney | 0 .10 RPM | 7 .54 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .22 RPM |
| SRP040447_lung | 0 .00 RPM | 4 .51 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 7 .11 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000008135 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies |
retro_cpor_1388 , retro_cpor_579,
|
| Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
| Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
| Homo sapiens | ENSG00000119705 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006030 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |