RetrogeneDB ID: | retro_btau_999 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 22:52930422..52930746(-) | ||
| Located in intron of: | ENSBTAG00000019841 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SLIRP | ||
| Ensembl ID: | ENSBTAG00000008135 | ||
| Aliases: | SLIRP, C10H14orf156 | ||
| Description: | SRA stem-loop-interacting RNA-binding protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q32P59] |
| Percent Identity: | 89.91 % |
| Parental protein coverage: | 98.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | ASAARGAMALRTNIGRPVAFVRKIPWTAASSELREHFAQFGHVRKCTVPFDKETGFHKGMGWIHFSSEEE |
| ASAARG.MALRTNIG..VAFVRKI...AASSELREHF.Q.GHVRKCTVPFDKETGFHKGMGWIHFSSEE. | |
| Retrocopy | ASAARGTMALRTNIGWLVAFVRKISGKAASSELREHFTQLGHVRKCTVPFDKETGFHKGMGWIHFSSEE- |
| Parental | LHNALQQENHVIDGVKLHVQPQRPKALQGDQTSDEEKDF |
| LHNALQQENHVIDGVK.HVQPQ.PKALQGDQTSDEEKDF | |
| Retrocopy | LHNALQQENHVIDGVKPHVQPQKPKALQGDQTSDEEKDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 14 .06 RPM |
| ERP005899_muscle | 0 .16 RPM | 51 .10 RPM |
| SRP017611_brain | 0 .14 RPM | 9 .32 RPM |
| SRP017611_kidney | 0 .30 RPM | 24 .36 RPM |
| SRP017611_liver | 0 .15 RPM | 10 .80 RPM |
| SRP030211_testis | 0 .07 RPM | 32 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000008135 | 3 retrocopies |
retro_btau_1439, retro_btau_430, retro_btau_999 ,
|
| Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
| Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
| Homo sapiens | ENSG00000119705 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006030 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |