RetrogeneDB ID: | retro_sscr_358 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 13:194632958..194633434(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LIN28 | ||
| Ensembl ID: | ENSSSCG00000003557 | ||
| Aliases: | LIN28A, LIN28, lin-28 | ||
| Description: | Sus scrofa lin-28 homolog A (C. elegans) (LIN28A), mRNA. [Source:RefSeq mRNA;Acc:NM_001123133] |
| Percent Identity: | 73.75 % |
| Parental protein coverage: | 77.56 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | MGSVSNQQFAGGCAKAPEEAPEDAARAAEEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALD-PPVDVF |
| M.SVSNQQ.AGGCAKAPEE.P...A.......LLHG.GIC.W..V..GFGFLSMT....VA.D.PPVDVF | |
| Retrocopy | MHSVSNQQLAGGCAKAPEEVPVEVALGSQGTKLLHGPGICNWLSVCKGFGFLSMTTCFWVAMD<PPVDVF |
| Parental | VHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKNMQKRRSKGDRCYNCG |
| .HQ.KLHME.F..LKEGEAVEFTF.KSAKGLESIRVT..GG.FCIGS.RRPK.KNMQKRR.KGDRCYN.G | |
| Retrocopy | *HQCKLHMEVFWNLKEGEAVEFTFMKSAKGLESIRVTSLGGLFCIGSKRRPKWKNMQKRRFKGDRCYN*G |
| Parental | GLDHHAKECKLPPQPKKCHF |
| .L.HHAKECK.PP.PKKCHF | |
| Retrocopy | CLHHHAKECKWPPHPKKCHF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 0 .00 RPM |
| SRP014902_testis | 0 .00 RPM | 0 .00 RPM |
| SRP018288_heart | 0 .00 RPM | 0 .00 RPM |
| SRP018288_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP018288_liver | 0 .00 RPM | 0 .00 RPM |
| SRP018288_lung | 0 .00 RPM | 0 .00 RPM |
| SRP018856_adipose | 0 .00 RPM | 0 .00 RPM |
| SRP035408_brain | 0 .00 RPM | 0 .00 RPM |
| SRP035408_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010582 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000040497 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000012488 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009796 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000019646 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010710 | 5 retrocopies | |
| Equus caballus | ENSECAG00000020267 | 1 retrocopy | |
| Homo sapiens | ENSG00000131914 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024918 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010158 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009294 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000000299 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003971 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001684 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000000384 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000017267 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000038409 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000003557 | 1 retrocopy |
retro_sscr_358 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000004329 | 1 retrocopy |