RetrogeneDB ID: | retro_sscr_271 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 11:74072935..74073316(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS15 | ||
| Ensembl ID: | ENSSSCG00000023248 | ||
| Aliases: | None | ||
| Description: | Sus scrofa ribosomal protein S15 (RPS15), mRNA. [Source:RefSeq mRNA;Acc:NM_214334] |
| Percent Identity: | 69.29 % |
| Parental protein coverage: | 87.59 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPM |
| MAEVEQK.K.TF.KFT..GVDL.QLLD.S..QL.QLYS..Q...L..GL.RKQHSLLK.L..AKKE.PP. | |
| Retrocopy | MAEVEQKMKQTFHKFTCCGVDLNQLLDTSFKQLTQLYSPWQQWSLKQGLQRKQHSLLKYLCRAKKEVPPL |
| Parental | EKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVK |
| .KPEV.K..L.D.IILPEMVG.MVG...GKTF.Q.E..PEMI.H.LGEFSITYKPVK | |
| Retrocopy | VKPEVGKMDLHDVIILPEMVGTMVGICKGKTFSQGEMEPEMI*HHLGEFSITYKPVK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 1184 .23 RPM |
| SRP014902_testis | 0 .00 RPM | 1324 .36 RPM |
| SRP018288_heart | 0 .00 RPM | 275 .79 RPM |
| SRP018288_kidney | 0 .00 RPM | 352 .16 RPM |
| SRP018288_liver | 0 .00 RPM | 268 .81 RPM |
| SRP018288_lung | 0 .00 RPM | 474 .51 RPM |
| SRP018856_adipose | 0 .00 RPM | 1183 .84 RPM |
| SRP035408_brain | 0 .00 RPM | 307 .38 RPM |
| SRP035408_liver | 0 .00 RPM | 365 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005632 | 13 retrocopies | |
| Cavia porcellus | ENSCPOG00000003968 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000706 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000008645 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002818 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000005119 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063457 | 8 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001651 | 8 retrocopies | |
| Otolemur garnettii | ENSOGAG00000015776 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000009317 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000010200 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000024603 | 8 retrocopies | |
| Sus scrofa | ENSSSCG00000023248 | 1 retrocopy |
retro_sscr_271 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000006423 | 2 retrocopies |