RetrogeneDB ID: | retro_dnov_85 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_1394:122764..123180(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS15 | ||
| Ensembl ID: | ENSDNOG00000000706 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S15 [Source:HGNC Symbol;Acc:10388] |
| Percent Identity: | 90. % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPM |
| MAEVEQKKK.TFRKFTYRGVD.DQLLDMSYEQLMQLYSA.QRR.LN.GLRRKQHSLLK.L.KAKK.APPM | |
| Retrocopy | MAEVEQKKKCTFRKFTYRGVDFDQLLDMSYEQLMQLYSAGQRRLLNHGLRRKQHSLLKQLHKAKKAAPPM |
| Parental | EKPEVVKTHLRDMIILP-EMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSS |
| EK.EVVKTHL.D.IILP..MVGSMVG.YNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSS | |
| Retrocopy | EKLEVVKTHLHDIIILP<QMVGSMVGIYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 19 .25 RPM | 619 .77 RPM |
| SRP012922_cerebellum | 9 .76 RPM | 286 .90 RPM |
| SRP012922_heart | 10 .21 RPM | 297 .23 RPM |
| SRP012922_kidney | 28 .47 RPM | 738 .15 RPM |
| SRP012922_liver | 11 .92 RPM | 357 .76 RPM |
| SRP012922_lung | 28 .41 RPM | 639 .76 RPM |
| SRP012922_quadricep_muscle | 12 .12 RPM | 560 .62 RPM |
| SRP012922_spleen | 23 .46 RPM | 870 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005632 | 13 retrocopies | |
| Cavia porcellus | ENSCPOG00000003968 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000706 | 2 retrocopies |
retro_dnov_173, retro_dnov_85 ,
|
| Echinops telfairi | ENSETEG00000008645 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002818 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000005119 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063457 | 8 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001651 | 8 retrocopies | |
| Otolemur garnettii | ENSOGAG00000015776 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000009317 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000010200 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000024603 | 8 retrocopies | |
| Sus scrofa | ENSSSCG00000023248 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000006423 | 2 retrocopies |