RetrogeneDB ID: | retro_sscr_1171 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | X:106562613..106562840(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSSSCG00000031018 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MINOS1 | ||
| Ensembl ID: | ENSSSCG00000028414 | ||
| Aliases: | None | ||
| Description: | mitochondrial inner membrane organizing system 1 [Source:HGNC Symbol;Acc:32068] |
| Percent Identity: | 84.42 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MSDSELGRKWDRCLADAVVKIGTGFGLGLVFSL-TFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLH |
| MSDS.L.RKWDRCL.D.VVKIGTG.GL.LVFSL..FFKRRMWPLA.GSGMGLGMAYSNCQHDFQA.YLLH | |
| Retrocopy | MSDSDLSRKWDRCLEDEVVKIGTGLGLRLVFSL<SFFKRRMWPLALGSGMGLGMAYSNCQHDFQALYLLH |
| Parental | GKYVKEQ |
| .K.VKEQ | |
| Retrocopy | RKHVKEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 32 .25 RPM |
| SRP014902_testis | 0 .00 RPM | 67 .05 RPM |
| SRP018288_heart | 0 .00 RPM | 90 .18 RPM |
| SRP018288_kidney | 0 .00 RPM | 98 .21 RPM |
| SRP018288_liver | 0 .00 RPM | 29 .26 RPM |
| SRP018288_lung | 0 .00 RPM | 44 .80 RPM |
| SRP018856_adipose | 0 .00 RPM | 136 .33 RPM |
| SRP035408_brain | 0 .00 RPM | 59 .23 RPM |
| SRP035408_liver | 0 .00 RPM | 46 .71 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003110 | 3 retrocopies | |
| Felis catus | ENSFCAG00000003066 | 2 retrocopies | |
| Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000016199 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000028414 | 1 retrocopy |
retro_sscr_1171 ,
|
| Tupaia belangeri | ENSTBEG00000004024 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000011525 | 1 retrocopy |