RetrogeneDB ID: | retro_amel_1685 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL193961.1:153762..153999(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MINOS1 | ||
| Ensembl ID: | ENSAMEG00000003110 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.07 % |
| Parental protein coverage: | 88.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | RVGNMSDSELGRKWDRCMADAVVK-IGTGFGLGLVFS-LTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQA |
| RVG.M..SELGRKWD...ADAVVK..GT.FG..LVFS.L.FF.RRMWP..FGSG.GLGM.YSNCQHDFQA | |
| Retrocopy | RVGDMPASELGRKWDPRGADAVVK<AGTAFGSRLVFSPLSFFQRRMWPIVFGSGLGLGMTYSNCQHDFQA |
| Parental | PY-LLHGKYVK |
| P..LL.GKYVK | |
| Retrocopy | PF>LLRGKYVK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003110 | 3 retrocopies |
retro_amel_1685 , retro_amel_502, retro_amel_689,
|
| Felis catus | ENSFCAG00000003066 | 2 retrocopies | |
| Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000016199 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000028414 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000004024 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000011525 | 1 retrocopy |