RetrogeneDB ID: | retro_mmus_2357 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:62274008..62274223(+) | ||
| Located in intron of: | ENSMUSG00000066152 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Minos1 | ||
| Ensembl ID: | ENSMUSG00000050608 | ||
| Aliases: | Minos1, 2310028O11Rik | ||
| Description: | mitochondrial inner membrane organizing system 1 [Source:MGI Symbol;Acc:MGI:1913628] |
| Percent Identity: | 56. % |
| Parental protein coverage: | 97.37 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | ESELGRKWDRCMADTV-VKLGTGFGLGIVFSLTFFKRRMWPLAFGSGVGLGMAYSNCQHDFQAPYLLHGK |
| E..L.RKW...M...V....GT.FG....F.LTF..RR.WPLA.GS..GL....SNCQHD.QAP.LL..K | |
| Retrocopy | EISLCRKWAWRMPSAV<ARTGTWFGVRSCF-LTF-GRRTWPLAVGSSMGLRLTCSNCQHDPQAPCLLR*K |
| Parental | YVKEQ |
| YVKEQ | |
| Retrocopy | YVKEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 53 .94 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 59 .53 RPM |
| SRP007412_heart | 0 .00 RPM | 123 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 91 .17 RPM |
| SRP007412_liver | 0 .00 RPM | 31 .32 RPM |
| SRP007412_testis | 0 .18 RPM | 61 .34 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003110 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
| Felis catus | ENSFCAG00000003066 | 2 retrocopies | |
| Homo sapiens | ENSG00000173436 | 3 retrocopies | |
| Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000016199 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000050608 | 1 retrocopy |
retro_mmus_2357 ,
|
| Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000028414 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000004024 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000011525 | 1 retrocopy |