RetrogeneDB ID: | retro_sscr_1061 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 9:73756204..73756630(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SDHC | ||
| Ensembl ID: | ENSSSCG00000030318 | ||
| Aliases: | SDHC, CYBL | ||
| Description: | Succinate dehydrogenase cytochrome b560 subunit, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:D0VWV4] |
| Percent Identity: | 68.28 % |
| Parental protein coverage: | 84.62 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 2 |
| Parental | AVPLGTTAKEEMER-FWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGN |
| A..LGT.A.EE....FWNKN..SN.PLSPH.TIY.WSLPMAMSICH.GTGI.LSAGVSLFGLSALL.PGN | |
| Retrocopy | AISLGTPA*EEKVE>FWNKNTSSNDPLSPHFTIYSWSLPMAMSICHHGTGISLSAGVSLFGLSALLFPGN |
| Parental | FESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSV- |
| F.S.L.L......G...I.TAKF..VFP.MYHT..GI.HL.WDL.KGL.I.QL.Q.GVV.L.LTVLSS.. | |
| Retrocopy | FGSLLNL*VPV-FGASIISTAKFALVFPFMYHTQDGI*HLMWDL*KGLMISQLPQAGVVALVLTVLSSE< |
| Parental | GLAAM |
| G.AAM | |
| Retrocopy | GVAAM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 21 .24 RPM |
| SRP014902_testis | 0 .00 RPM | 47 .81 RPM |
| SRP018288_heart | 0 .00 RPM | 158 .26 RPM |
| SRP018288_kidney | 0 .00 RPM | 436 .97 RPM |
| SRP018288_liver | 0 .00 RPM | 181 .50 RPM |
| SRP018288_lung | 0 .00 RPM | 28 .21 RPM |
| SRP018856_adipose | 0 .00 RPM | 142 .44 RPM |
| SRP035408_brain | 0 .00 RPM | 95 .98 RPM |
| SRP035408_liver | 0 .00 RPM | 273 .27 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015351 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000015853 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012992 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000004757 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000015767 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000499 | 1 retrocopy | |
| Homo sapiens | ENSG00000143252 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008017 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000012411 | 11 retrocopies | |
| Mustela putorius furo | ENSMPUG00000014439 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014367 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000001585 | 4 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005544 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000003163 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000016835 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030318 | 2 retrocopies |
retro_sscr_1050, retro_sscr_1061 ,
|
| Takifugu rubripes | ENSTRUG00000001873 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009234 | 1 retrocopy |