RetrogeneDB ID: | retro_shar_303 | ||
Retrocopylocation | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL841279.1:1793890..1794130(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS24 | ||
| Ensembl ID: | ENSSHAG00000008090 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S24 [Source:HGNC Symbol;Acc:10411] |
| Percent Identity: | 56.79 % |
| Parental protein coverage: | 56.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MLKLAGNRAPRANDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFG |
| .L.L....A...NDT..I..RKF.TNRLL..KQMVIDV.H.GK.T..K....EKL.K.YKT..D..FVF. | |
| Retrocopy | LLLLLKELAATINDTMSIKPRKFITNRLLHFKQMVIDVYH-GKVTKSKIGNQEKLVKIYKTVSDAFFVFV |
| Parental | FRTHFGGGKTT |
| F.THF.GGK.T | |
| Retrocopy | FGTHFVGGKIT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |