RetrogeneDB ID: | retro_rnor_1935 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 3:156370895..156371114(-) | ||
| Located in intron of: | ENSRNOG00000016352 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | H2afv | ||
| Ensembl ID: | ENSRNOG00000007026 | ||
| Aliases: | LOC685909, H2A.Z-2, H2afv | ||
| Description: | H2A histone family, member V [Source:RefSeq peptide;Acc:NP_001099489] |
| Percent Identity: | 71.62 % |
| Parental protein coverage: | 57.81 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | AVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK |
| A..SAA.LEYL.A..LELAGNASKD.KVK.I.P.HLQLAI.G.EELDSLIKATI.GGGV.P.IHKSL..K | |
| Retrocopy | ATNSAATLEYLVAKALELAGNASKDFKVKCINPHHLQLAICG-EELDSLIKATITGGGVSPQIHKSLRRK |
| Parental | KGQQ |
| .... | |
| Retrocopy | DNRR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 9 .42 RPM |
| SRP017611_kidney | 0 .00 RPM | 11 .93 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .92 RPM |