RetrogeneDB ID: | retro_vpac_608 | ||
Retrocopylocation | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | scaffold_678:224038..224336(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | H2AFV | ||
| Ensembl ID: | ENSVPAG00000004507 | ||
| Aliases: | None | ||
| Description: | H2A histone family, member V [Source:HGNC Symbol;Acc:20664] |
| Percent Identity: | 56.31 % |
| Parental protein coverage: | 94.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | GGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHR-HLKTRTTSHGRVGATAAVYSAAILEYLTAEVL-ELA |
| G.KA.K.SGK.K....S.SQRA.LQF..G.IH...LK.RTT.H..VG..A.VYSAAILEYLT.E.L..LA | |
| Retrocopy | GDKAWKNSGKVKTNVASCSQRASLQFLFGHIHG<RLKSRTTNH*CVGTMATVYSAAILEYLTGEDL<DLA |
| Parental | GNASKDLKLNGSLPRHLQLAFRGDEKLDSSIKA |
| GN.S.DL......P....L....DE.LDS.IKA | |
| Retrocopy | GNTSNDL-VKSITPSQFLLTICKDEELDSLIKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000889 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011953 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000769 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000000793 | 5 retrocopies | |
| Homo sapiens | ENSG00000105968 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014500 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000041126 | 2 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000009378 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008133 | 10 retrocopies | |
| Otolemur garnettii | ENSOGAG00000025145 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015604 | 3 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000005931 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000019153 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000007026 | 5 retrocopies | |
| Sus scrofa | ENSSSCG00000016738 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011533 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013840 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000004507 | 1 retrocopy |
retro_vpac_608 ,
|