RetrogeneDB ID: | retro_rnor_1246 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 17:304375..304669(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Atp6v1g1 | ||
| Ensembl ID: | ENSRNOG00000008163 | ||
| Aliases: | None | ||
| Description: | V-type proton ATPase subunit G 1 [Source:RefSeq peptide;Acc:NP_001100130] |
| Percent Identity: | 82.83 % |
| Parental protein coverage: | 83.9 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCS |
| M...SQGIQQLLQAEK.AAEKVS.A...KN.RLKQAKE.AQAEIEQY.LQREKEFKAKEAAALG.HGSCS | |
| Retrocopy | MGNDSQGIQQLLQAEKQAAEKVSTA*EPKNERLKQAKE-AQAEIEQYVLQREKEFKAKEAAALGTHGSCS |
| Parental | SEVEKETQEKMTILQNYFEQNRDEVLDNL |
| .EVEK.TQE..TILQNYFEQNRD.VLDNL | |
| Retrocopy | REVEK*TQEQRTILQNYFEQNRD*VLDNL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .36 RPM | 82 .11 RPM |
| SRP017611_kidney | 0 .98 RPM | 106 .00 RPM |
| SRP017611_liver | 0 .34 RPM | 51 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
| Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
| Equus caballus | ENSECAG00000011155 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008080 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000015368 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000039105 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000010103 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000008334 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000008163 | 2 retrocopies |
retro_rnor_1246 , retro_rnor_676,
|
| Tursiops truncatus | ENSTTRG00000015203 | 2 retrocopies |