RetrogeneDB ID: | retro_ptro_1412 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 20:4609404..4610034(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | IDI1 | ||
| Ensembl ID: | ENSPTRG00000002239 | ||
| Aliases: | None | ||
| Description: | isopentenyl-diphosphate delta isomerase 1 [Source:HGNC Symbol;Acc:5387] |
| Percent Identity: | 68.37 % |
| Parental protein coverage: | 74.3 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 4 |
| Parental | LAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNT-ENKLLLQQRSDAKITFPGCFTNTC |
| ..E.CILIDEND..IG.ETKKNCH.NEN...GLLH.A.SVFL.NT..N.LL.QQRSDA.ITF...FTNTC | |
| Retrocopy | ITEKCILIDENDSNIGTETKKNCHVNENFGNGLLHQALSVFLLNT<QNELL*QQRSDAEITF*ASFTNTC |
| Parental | -CSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILL |
| .CSHPLSNP..LE..D..G....AQR.LKAELGIP.EE.PPEE..YL.......QSDGIWGEH..DYIL. | |
| Retrocopy | >CSHPLSNPDKLERNDVIGIS*VAQRHLKAELGIPMEEAPPEETYYLISTCSEVQSDGIWGEHKTDYILF |
| Parental | VRKNVTLNPDPNEIKSYCY-VSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHE- |
| VRKN.T.N.DP.E.KSY...VSKEEL.ELL.K...GEIKITP.F..I..TFLFKWWDNL.HLNQF.DHE. | |
| Retrocopy | VRKNITSNSDPSEMKSYFL>VSKEEL-ELLRKVVIGEIKITP*FQVIIETFLFKWWDNLSHLNQFIDHE< |
| Parental | KIYRM |
| KIYRM | |
| Retrocopy | KIYRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 13 .80 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 13 .80 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .61 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .56 RPM |
| SRP007412_liver | 0 .00 RPM | 8 .71 RPM |
| SRP007412_testis | 0 .00 RPM | 12 .44 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2444 |
| Gorilla gorilla | retro_ggor_1521 |
| Pongo abelii | retro_pabe_1783 |
| Macaca mulatta | retro_mmul_632 |
| Callithrix jacchus | retro_cjac_2591 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000008483 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000012555 | 3 retrocopies | |
| Homo sapiens | ENSG00000067064 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000934 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000017115 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000005998 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000058258 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013594 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007493 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000008692 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002039 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000002239 | 3 retrocopies |
retro_ptro_1412 , retro_ptro_1647, retro_ptro_2747,
|
| Ictidomys tridecemlineatus | ENSSTOG00000023260 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011174 | 1 retrocopy |