RetrogeneDB ID: | retro_ptro_1012 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 15:44002544..44002990(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CYB5B | ||
| Ensembl ID: | ENSPTRG00000008282 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes cytochrome b5 type B (CYB5B), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001242609] |
| Percent Identity: | 69.54 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQA |
| .S..MAT..AS.SD.KGQ.V.TS.TY..LEEV.K.N.LKEL.LVIHGR.YDV..F....PG.E.VLLEQA | |
| Retrocopy | ISSPMATVQASSSDEKGQGVGTSTTY*QLEEVVKQNFLKELCLVIHGRLYDVPHF-EDPPGREKVLLEQA |
| Parental | GVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGS-KDPSKNDTCKSCWAYWILPIIGAVLLGFL |
| G.DA.ESF.DVGHSSDAREMLKQYYIG..H.SDLKPE....KD.SKNDTCKS.W.YWI.PIIGA.LLG.L | |
| Retrocopy | GADATESFVDVGHSSDAREMLKQYYIGAVHLSDLKPENCA<KDSSKNDTCKSFWPYWIFPIIGAILLGYL |
| Parental | YRYYTSESKSS |
| ...Y..ESKSS | |
| Retrocopy | SHSYILESKSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 53 .41 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 32 .19 RPM |
| SRP007412_heart | 0 .00 RPM | 31 .89 RPM |
| SRP007412_kidney | 0 .05 RPM | 50 .63 RPM |
| SRP007412_liver | 0 .00 RPM | 39 .38 RPM |
| SRP007412_testis | 0 .11 RPM | 40 .26 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1493 |
| Gorilla gorilla | retro_ggor_1146 |
| Pongo abelii | retro_pabe_1243 |
| Macaca mulatta | retro_mmul_128 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anas platyrhynchos | ENSAPLG00000007518 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008313 | 9 retrocopies | |
| Felis catus | ENSFCAG00000024541 | 1 retrocopy | |
| Homo sapiens | ENSG00000103018 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000000660 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015031 | 1 retrocopy | |
| Meleagris gallopavo | ENSMGAG00000008619 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006608 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012039 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005515 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000007729 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007506 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008282 | 1 retrocopy |
retro_ptro_1012 ,
|
| Pan troglodytes | ENSPTRG00000010111 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015984 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000014200 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014292 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010016 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0029854 | 1 retrocopy |