RetrogeneDB ID: | retro_dnov_716 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_101265:7857..8094(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CYB5B | ||
| Ensembl ID: | ENSDNOG00000008313 | ||
| Aliases: | None | ||
| Description: | cytochrome b5 type B (outer mitochondrial membrane) [Source:HGNC Symbol;Acc:24374] |
| Percent Identity: | 69.62 % |
| Parental protein coverage: | 53.74 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | VASSSSKELWLVIHGQIYDVSSFLNEXXXXXEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDVHPS |
| V...S.K.LWLVIHG..YDVS.FL.E.....EVLLEQ.G..ASESFED.GHS.DA.EMLKQYYIG..HP. | |
| Retrocopy | VKHNSLKKLWLVIHGGVYDVSGFLAEHPGGEEVLLEQDGTNASESFEDIGHSFDATEMLKQYYIGYFHPN |
| Parental | DIKTESGSK |
| DIKTES.SK | |
| Retrocopy | DIKTESDSK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 16 .53 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 6 .46 RPM |
| SRP012922_heart | 0 .00 RPM | 7 .19 RPM |
| SRP012922_kidney | 0 .00 RPM | 16 .43 RPM |
| SRP012922_liver | 0 .00 RPM | 2 .48 RPM |
| SRP012922_lung | 0 .00 RPM | 8 .71 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 3 .98 RPM |
| SRP012922_spleen | 0 .23 RPM | 10 .42 RPM |