RetrogeneDB ID: | retro_nleu_1715 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397306.1:7790803..7791250(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CYB5B | ||
| Ensembl ID: | ENSNLEG00000005515 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.71 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEE-VLLEQ |
| .S..M.TA.AS.SD.KGQ.V.TS.TYY.LEEV.K.NSLKELWLVIHG..Y.V..F....PG.E..VLLEQ | |
| Retrocopy | ISSPMVTAKASSSDEKGQGVGTSTTYYQLEEVVKQNSLKELWLVIHG*LYNVPHF-EDPPGREK<VLLEQ |
| Parental | AGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPEN-GSKDPSKNDTCKSCWAYWILPIVGAVLLGF |
| AG.DA.ESFEDVGHSSDAREMLKQYYIG..H.SDLKP.N..SKDP.KNDTCKS.W.YWI.PIVGA.LLG. | |
| Retrocopy | AGADATESFEDVGHSSDAREMLKQYYIGAVHLSDLKPGN>VSKDPLKNDTCKSFWPYWIFPIVGAILLGY |
| Parental | LYRYYTSESKSS |
| L...Y.SESKSS | |
| Retrocopy | LPHSYISESKSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anas platyrhynchos | ENSAPLG00000007518 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008313 | 9 retrocopies | |
| Felis catus | ENSFCAG00000024541 | 1 retrocopy | |
| Homo sapiens | ENSG00000103018 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000000660 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015031 | 1 retrocopy | |
| Meleagris gallopavo | ENSMGAG00000008619 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006608 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012039 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005515 | 1 retrocopy |
retro_nleu_1715 ,
|
| Nomascus leucogenys | ENSNLEG00000009232 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000007729 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007506 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008282 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000015984 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000014200 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014292 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010016 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0029854 | 1 retrocopy |