RetrogeneDB ID: | retro_pcap_124 | ||
Retrocopylocation | Organism: | Hyrax (Procavia capensis) | |
| Coordinates: | GeneScaffold_7476:23211..23429(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSPCAG00000015357 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPLP1 | ||
| Ensembl ID: | ENSPCAG00000014595 | ||
| Aliases: | None | ||
| Description: | ribosomal protein, large, P1 [Source:HGNC Symbol;Acc:10372] |
| Percent Identity: | 51.35 % |
| Parental protein coverage: | 64.04 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | ELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVN-IGSLICNVGAGGPAPAPGA |
| EL.CI...LILH..E..V....I..LI.AA..N.E..W.G.F.K.L..V..IGSLIC..GAGG.A.A... | |
| Retrocopy | ELFCID*TLILHNNEQIVIAGQITSLIEAASINAELGWTGWFTKILSRVK<IGSLICSEGAGGTASAGDP |
| Parental | APAG |
| AP.G | |
| Retrocopy | AP*G |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |