RetrogeneDB ID: | retro_ggor_2163 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 5:40847791..40847989(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPLP1 | ||
| Ensembl ID: | ENSGGOG00000003980 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 57.89 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAG |
| MASVS.LAC.YSALIL.D.EVT.TEDKINALIKAA.VN.E.FWPGLFAK.LANVNIGS.ICNVG.G | |
| Retrocopy | MASVSQLACVYSALILQDYEVTFTEDKINALIKAASVNIETFWPGLFAKVLANVNIGSHICNVGGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .19 RPM | 66 .27 RPM |
| SRP007412_cerebellum | 0 .20 RPM | 80 .18 RPM |
| SRP007412_heart | 0 .03 RPM | 158 .29 RPM |
| SRP007412_kidney | 0 .12 RPM | 154 .31 RPM |
| SRP007412_liver | 0 .11 RPM | 293 .98 RPM |
| SRP007412_testis | 0 .21 RPM | 83 .92 RPM |