>retro_pabe_1869
CGCCAGGAATCATCCGGCCTGATCAAGGGGAATAAGCAGACCCACAGCACTGAGCCTGAGAACTTAAAGGCTGCAGCTCC
TTCCACTACAACGAGCTGATTCACCGCAGGACTGTGGGTGTGGACCCGGCAGCTGATGGCAAAGGTGTGGTGGTGGTCAT
GGAGTGGAGATCTGGCCAGCAAAAGCCAGCCACCTCCTATGAGGGGACTACTGTC
ORF - retro_pabe_1869 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: |
72.6 % |
| Parental protein coverage: |
52.55 % |
| Number of stop codons detected: |
0 |
| Number of frameshifts detected |
1 |
Retrocopy - Parental Gene Alignment:
| Parental | RNCSSFLIKRNKQTYSTEPNNLKAR-NSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVR |
| | R..SS.LIK.NKQT.STEP.NLKA...SF.YN.LIHR.TVGV.PAADGKGVVVV...RSGQ.KPATSY.. |
| Retrocopy | RQESSGLIKGNKQTHSTEPENLKAA<SSFHYNELIHRRTVGVDPAADGKGVVVVMEWRSGQQKPATSYEG |
|
| Parental | TTI |
| | TT. |
| Retrocopy | TTV |
|
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library |
Retrocopy expression |
Parental gene expression |
| SRP007412_brain_prefrontal_cortex |
0 .06 RPM |
60 .32 RPM |
| SRP007412_cerebellum |
0 .00 RPM |
38 .79 RPM |
| SRP007412_heart |
0 .03 RPM |
43 .92 RPM |
| SRP007412_kidney |
0 .03 RPM |
113 .56 RPM |
| SRP007412_liver |
0 .06 RPM |
118 .73 RPM |
Pongo abelii was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_pabe_1869 retrocopy.
Pongo abelii was not studied using FANTOM5 data.
retro_pabe_1869 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_pabe_1869 has 0 orthologous retrocopies within eutheria group .
Parental genes homology:
Parental genes homology involve
29 parental genes, and
117 retrocopies.
| Species |
Parental gene accession |
Retrocopies number |
|
| Anolis carolinensis | ENSACAG00000015980 | 1 retrocopy |
|
| Ailuropoda melanoleuca | ENSAMEG00000003764 | 15 retrocopies |
retro_amel_1006, retro_amel_1099, retro_amel_1155, retro_amel_1369, retro_amel_1393, retro_amel_1465, retro_amel_1737, retro_amel_231, retro_amel_289, retro_amel_33, retro_amel_474, retro_amel_556, retro_amel_630, retro_amel_822, retro_amel_829,
|
| Bos taurus | ENSBTAG00000023343 | 5 retrocopies |
|
| Canis familiaris | ENSCAFG00000002585 | 8 retrocopies |
|
| Callithrix jacchus | ENSCJAG00000000869 | 1 retrocopy |
|
| Cavia porcellus | ENSCPOG00000012833 | 2 retrocopies |
|
| Dipodomys ordii | ENSDORG00000012809 | 2 retrocopies |
|
| Equus caballus | ENSECAG00000026938 | 2 retrocopies |
|
| Felis catus | ENSFCAG00000005639 | 15 retrocopies |
retro_fcat_1045, retro_fcat_1214, retro_fcat_1397, retro_fcat_1404, retro_fcat_1463, retro_fcat_1629, retro_fcat_1663, retro_fcat_171, retro_fcat_233, retro_fcat_484, retro_fcat_575, retro_fcat_786, retro_fcat_904, retro_fcat_910, retro_fcat_942,
|
| Homo sapiens | ENSG00000108107 | 4 retrocopies |
|
| Gorilla gorilla | ENSGGOG00000022653 | 4 retrocopies |
|
| Loxodonta africana | ENSLAFG00000022257 | 2 retrocopies |
|
| Macropus eugenii | ENSMEUG00000015744 | 1 retrocopy |
|
| Myotis lucifugus | ENSMLUG00000023789 | 1 retrocopy |
|
| Macaca mulatta | ENSMMUG00000015901 | 1 retrocopy |
|
| Monodelphis domestica | ENSMODG00000000275 | 1 retrocopy |
|
| Mustela putorius furo | ENSMPUG00000007450 | 10 retrocopies |
retro_mputfur_1014, retro_mputfur_1050, retro_mputfur_1426, retro_mputfur_470, retro_mputfur_639, retro_mputfur_763, retro_mputfur_804, retro_mputfur_855, retro_mputfur_909, retro_mputfur_951,
|
| Mus musculus | ENSMUSG00000030432 | 10 retrocopies |
retro_mmus_162, retro_mmus_1679, retro_mmus_1911, retro_mmus_2511, retro_mmus_2526, retro_mmus_2606, retro_mmus_2629, retro_mmus_3149, retro_mmus_362, retro_mmus_738,
|
| Nomascus leucogenys | ENSNLEG00000010503 | 4 retrocopies |
|
| Otolemur garnettii | ENSOGAG00000025533 | 4 retrocopies |
|
| Ochotona princeps | ENSOPRG00000000463 | 1 retrocopy |
|
| Petromyzon marinus | ENSPMAG00000008617 | 1 retrocopy |
|
| Pongo abelii |