RetrogeneDB ID: | retro_cfam_581 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 13:52857468..52857863(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL28 | ||
| Ensembl ID: | ENSCAFG00000002585 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L28 [Source:HGNC Symbol;Acc:10330] |
| Percent Identity: | 58.96 % |
| Parental protein coverage: | 97.08 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFR-YNGLIHRKTVGVEPAADGKGVVVVLKRRSG |
| M..HLQWMV..NCSSFLIK.NKQTYST.P.NLKA.NSF..Y.GLI..KT.........KG.VV...RRSG | |
| Retrocopy | MVTHLQWMVLCNCSSFLIKMNKQTYSTKPRNLKAHNSFP<YDGLIRCKTMVRSFRPESKGTVVGM-RRSG |
| Parental | QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRARP |
| Q.KPAT.Y..TTINKN..A.L..IRHM..KNKY.PDL.M.............KPVMVKRK...P | |
| Retrocopy | Q*KPATPYEWTTINKNFWASLHRIRHMVCKNKYHPDLCMXXXXXXXXXXXXXKPVMVKRKKLLP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 183 .03 RPM |
| SRP017611_brain | 0 .00 RPM | 48 .35 RPM |
| SRP017611_kidney | 0 .07 RPM | 297 .70 RPM |
| SRP017611_liver | 0 .00 RPM | 121 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000015980 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000003764 | 15 retrocopies | |
| Canis familiaris | ENSCAFG00000002585 | 8 retrocopies |
retro_cfam_1009, retro_cfam_1192, retro_cfam_2145, retro_cfam_350, retro_cfam_462, retro_cfam_533, retro_cfam_581 , retro_cfam_879,
|
| Callithrix jacchus | ENSCJAG00000000869 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012833 | 2 retrocopies | |
| Felis catus | ENSFCAG00000005639 | 15 retrocopies | |
| Loxodonta africana | ENSLAFG00000022257 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000015744 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023789 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015901 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000275 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000030432 | 10 retrocopies | |
| Ochotona princeps | ENSOPRG00000000463 | 1 retrocopy | |
| Petromyzon marinus | ENSPMAG00000008617 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010417 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017127 | 5 retrocopies |