RetrogeneDB ID: | retro_ogar_2937 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873685.1:2370345..2370665(+) | ||
| Located in intron of: | ENSOGAG00000000662 | ||
Retrocopyinformation | Ensembl ID: | ENSOGAG00000006125 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SKA2 | ||
| Ensembl ID: | ENSOGAG00000026072 | ||
| Aliases: | None | ||
| Description: | spindle and kinetochore associated complex subunit 2 [Source:HGNC Symbol;Acc:28006] |
| Percent Identity: | 81.82 % |
| Parental protein coverage: | 89.34 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | IFQKADSDLDYIQYRLEYEIKTNYPDSAGEKSPVTLLKEISAIKSRYQTLYTRFKLVAVEQQETKSRICA |
| .FQKA.SDLDYI.Y.LEYEIKTN.PDSAGEKSPVTLLKE.SAIKSRYQTLY..FKLVAVEQ.ETKS.ICA | |
| Retrocopy | MFQKAYSDLDYIRYKLEYEIKTNLPDSAGEKSPVTLLKEMSAIKSRYQTLYACFKLVAVEQKETKSCICA |
| Parental | TVNKTMNMIQ-QLQTQTDLELSPLTEEEKNAAEQLKSHMP |
| TVNKTMNM...Q.QT.....LSPLTEEEKNA.EQLKSHMP | |
| Retrocopy | TVNKTMNMNY<QKQTHLE--LSPLTEEEKNAPEQLKSHMP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000021680 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000029233 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006051 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000010768 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015007 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022802 | 1 retrocopy | |
| Homo sapiens | ENSG00000182628 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003405 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010942 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014619 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015241 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020492 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026072 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000025981 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000011128 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024169 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006158 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000017196 | 1 retrocopy |