RetrogeneDB ID: | retro_cpor_542 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_19:2654009..2654321(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SKA2 | ||
| Ensembl ID: | ENSCPOG00000006051 | ||
| Aliases: | None | ||
| Description: | spindle and kinetochore associated complex subunit 2 [Source:HGNC Symbol;Acc:28006] |
| Percent Identity: | 64.42 % |
| Parental protein coverage: | 85.95 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | SDLDYIQYRLEYEIKTNHPDSAGEKNPVTLLKELSAIKSRYQTLCDHYKRVATEQKEIKTRISTTLNKTM |
| .DLDYIQYRLEYEIKTN..DSAGEKN.V.LL.ELS..KS...TL....K..A.EQKE.K..I.TTL..TM | |
| Retrocopy | TDLDYIQYRLEYEIKTNYLDSAGEKNLVILLQELSVVKSQQETLHACFKPIAIEQKETKSHIYTTLDTTM |
| Parental | TRIQELQKLTDVELLPPTEEEKTATEQLKSHREH |
| T.IQE..K..D..L.P.TEEE.T.TEQLKSH..H | |
| Retrocopy | TMIQE**KQIDATLSPLTEEETTVTEQLKSHTPH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 3 .39 RPM |
| SRP017611_kidney | 0 .00 RPM | 1 .88 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .09 RPM |
| SRP040447_lung | 0 .00 RPM | 2 .75 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 0 .71 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000021680 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000029233 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006051 | 1 retrocopy |
retro_cpor_542 ,
|
| Dipodomys ordii | ENSDORG00000010768 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015007 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022802 | 1 retrocopy | |
| Homo sapiens | ENSG00000182628 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003405 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010942 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014619 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015241 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020492 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026072 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000025981 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000011128 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024169 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006158 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000017196 | 1 retrocopy |