RetrogeneDB ID: | retro_btau_310 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 1:116197013..116197376(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSBTAG00000033740 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BT.89449 | ||
| Ensembl ID: | ENSBTAG00000021680 | ||
| Aliases: | SKA2, FAM33A | ||
| Description: | spindle and kinetochore-associated protein 2 [Source:RefSeq peptide;Acc:NP_001033668] |
| Percent Identity: | 98.35 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MEAEVDKLELMFQKADSDLDYIQYRLEYEIKTNYPDSAGKKNPVTLLKELSAIKSRYQTLHVRFKPIAVE |
| MEAEVDKLELMFQKADSDLDYIQYRLEYEIKTNYPDSAGKKNPVTLLKELSAIKSRYQTLHVRFKP.AVE | |
| Retrocopy | MEAEVDKLELMFQKADSDLDYIQYRLEYEIKTNYPDSAGKKNPVTLLKELSAIKSRYQTLHVRFKPTAVE |
| Parental | QKETKSRICATFNKTMTLIQELQKETDLELLPLTEEEKTAAEQLRAHMSDL |
| QKETKSRICATFNKT.TLIQELQKETDLELLPLTEEEKTAAEQLRAHMSDL | |
| Retrocopy | QKETKSRICATFNKTLTLIQELQKETDLELLPLTEEEKTAAEQLRAHMSDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 7 .21 RPM |
| ERP005899_muscle | 0 .00 RPM | 8 .39 RPM |
| SRP017611_brain | 0 .05 RPM | 14 .30 RPM |
| SRP017611_kidney | 0 .06 RPM | 11 .38 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .64 RPM |
| SRP030211_testis | 0 .05 RPM | 24 .66 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000021680 | 2 retrocopies |
retro_btau_310 , retro_btau_945,
|
| Canis familiaris | ENSCAFG00000029233 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006051 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000010768 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015007 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022802 | 1 retrocopy | |
| Homo sapiens | ENSG00000182628 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003405 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010942 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014619 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015241 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020492 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026072 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000025981 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000011128 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024169 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006158 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000017196 | 1 retrocopy |