RetrogeneDB ID: | retro_ogar_2041 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873583.1:7381887..7382133(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CYB5A | ||
| Ensembl ID: | ENSOGAG00000000052 | ||
| Aliases: | None | ||
| Description: | cytochrome b5 type A (microsomal) [Source:HGNC Symbol;Acc:2570] |
| Percent Identity: | 72.62 % |
| Parental protein coverage: | 61.19 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | EQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDRS-KITKPSETLITTVDSNSSWWTNWVIPAVSAL |
| ...GGDATENFE..GHSTDA.E.SKTYIIG.LH.DDRS.K.TKPSETLITTVD.NS.WWTN.VI.A.SAL | |
| Retrocopy | KRTGGDATENFEYIGHSTDAWEPSKTYIIGDLHSDDRS<KVTKPSETLITTVDPNSNWWTNRVILAISAL |
| Parental | LVAL-MYRLYVAED |
| .V.L..Y..Y.AED | |
| Retrocopy | VVTL>IYYFYMAED |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |