RetrogeneDB ID: | retro_ocun_917 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 17:59841100..59841417(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DCTN6 | ||
| Ensembl ID: | ENSOCUG00000010968 | ||
| Aliases: | None | ||
| Description: | dynactin 6 [Source:HGNC Symbol;Acc:16964] |
| Percent Identity: | 63.3 % |
| Parental protein coverage: | 55.79 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | PGAVVCVESEIRGDVTIGPRTVIHPKA-RIIAEAGPIVIGEGNLI-EEQAL-IINAYPDNITPDVEDPEP |
| PGAVVCVESEI..D..IG.RTVIH.KA.RIIAEA..IVIGEGNLI..EQ.L...........PDVED..P | |
| Retrocopy | PGAVVCVESEIQADINIGSRTVIHAKA>RIIAEARLIVIGEGNLI<IEQPL<VMDVHLGCLIPDVEDQVP |
| Parental | KPMVIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVI |
| .PM.IGTN.VFEV.C.SQAMK..DNN.I..K.Y....VI | |
| Retrocopy | EPMIIGTNTVFEVCCSSQAMKVVDNNLIRLKVYEDKKVI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 32 .67 RPM |
| SRP017611_kidney | 0 .00 RPM | 13 .28 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001497 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000006518 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000002554 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000011021 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000012307 | 2 retrocopies | |
| Felis catus | ENSFCAG00000000133 | 1 retrocopy | |
| Homo sapiens | ENSG00000104671 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013074 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000028330 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013735 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019010 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011906 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010968 | 1 retrocopy |
retro_ocun_917 ,
|
| Ochotona princeps | ENSOPRG00000005061 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000020134 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013306 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012439 | 1 retrocopy |