RetrogeneDB ID: | retro_ggor_2236 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 5:18030804..18031154(-) | ||
| Located in intron of: | ENSGGOG00000015686 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DCTN6 | ||
| Ensembl ID: | ENSGGOG00000013074 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.9 % |
| Parental protein coverage: | 65.73 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | GPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGC-YSQA |
| G.RT.IHPKA.IIAEAGP.VIG.GNLIEEQALIINA..DNIT.DT.DPEPKPMIIGTNNVF.VG...SQA | |
| Retrocopy | GTRTAIHPKAQIIAEAGPVVIGKGNLIEEQALIINASSDNITLDTGDPEPKPMIIGTNNVFKVGV<HSQA |
| Parental | MKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGA |
| M.MGDNNVIE.K.YVGRN.ILTSGC..GACCNLNTFEVIPENTVIYGA | |
| Retrocopy | MEMGDNNVIELKVYVGRNLILTSGCLTGACCNLNTFEVIPENTVIYGA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 25 .32 RPM |
| SRP007412_cerebellum | 0 .20 RPM | 16 .63 RPM |
| SRP007412_heart | 0 .06 RPM | 5 .22 RPM |
| SRP007412_kidney | 0 .04 RPM | 17 .42 RPM |
| SRP007412_liver | 0 .08 RPM | 8 .84 RPM |
| SRP007412_testis | 0 .00 RPM | 18 .23 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1780 |
| Pan troglodytes | retro_ptro_1191 |
| Macaca mulatta | retro_mmul_1241 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001497 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000006518 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000002554 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000011021 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000012307 | 2 retrocopies | |
| Felis catus | ENSFCAG00000000133 | 1 retrocopy | |
| Homo sapiens | ENSG00000104671 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013074 | 1 retrocopy |
retro_ggor_2236 ,
|
| Myotis lucifugus | ENSMLUG00000028330 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013735 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019010 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011906 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010968 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005061 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000020134 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013306 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012439 | 1 retrocopy |