RetrogeneDB ID: | retro_ocun_837 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 15:63294693..63295051(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS16 | ||
| Ensembl ID: | ENSOCUG00000002150 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S16 [Source:HGNC Symbol;Acc:10396] |
| Percent Identity: | 59.84 % |
| Parental protein coverage: | 69.19 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 3 |
| Parental | GNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVA-YY |
| G.GLIK.N....E..EP..L.YKLLE..L.LGKE.FA..DI.V.VKG..HVAQ..AI...ISKALVA.Y. | |
| Retrocopy | GSGLIKTNRLSPEVTEPHKL*YKLLEYSLILGKEQFAVMDIHVFVKGHSHVAQSDAIHPCISKALVA<Y* |
| Parental | QKYVDEASKKEIKD-ILIQYDRTLLVAD-PRRCESKKFGGPGARARYQKSYR |
| QK..DEASKKE.K..ILIQYD.TLL..D.....ESK.F.GP...A..QKSY. | |
| Retrocopy | QKHKDEASKKETKE>ILIQYDKTLLGVD>SHH*ESKRF*GPAFPASHQKSYQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 68 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 174 .43 RPM |
| SRP017611_liver | 0 .00 RPM | 44 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000014176 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000021093 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000005501 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014170 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000011359 | 3 retrocopies | |
| Equus caballus | ENSECAG00000004311 | 2 retrocopies | |
| Felis catus | ENSFCAG00000010743 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014414 | 10 retrocopies | |
| Loxodonta africana | ENSLAFG00000001541 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019370 | 8 retrocopies | |
| Monodelphis domestica | ENSMODG00000013545 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014388 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002150 | 14 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004497 | 4 retrocopies | |
| Oreochromis niloticus | ENSONIG00000000006 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000016930 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019578 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000010712 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000020817 | 3 retrocopies |