RetrogeneDB ID: | retro_acar_194 | ||
Retrocopylocation | Organism: | Anole lizard (Anolis carolinensis) | |
| Coordinates: | GL343544.1:51566..51812(-) | ||
| Located in intron of: | ENSACAG00000004543 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS16 | ||
| Ensembl ID: | ENSACAG00000014176 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.9 % |
| Parental protein coverage: | 57.53 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MPAKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRV |
| ..AKGPLQS.QVFGRKKTATA..HCKRGN.LIKVNGRPLEMIEPRTLQYK.LEPVLLLGKERF.GVDIRV | |
| Retrocopy | LDAKGPLQSMQVFGRKKTATA--HCKRGNSLIKVNGRPLEMIEPRTLQYKRLEPVLLLGKERFTGVDIRV |
| Parental | RVKGGGHVAQIYAI |
| .VKGGGHV.QIY.I | |
| Retrocopy | HVKGGGHVVQIYTI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP009831_adrenal | 0 .00 RPM | 2239 .08 RPM |
| SRP009831_brain | 0 .05 RPM | 216 .30 RPM |
| SRP009831_dewlap | 0 .00 RPM | 376 .48 RPM |
| SRP009831_embryo | 0 .03 RPM | 777 .29 RPM |
| SRP009831_heart | 0 .05 RPM | 518 .72 RPM |
| SRP009831_liver | 0 .00 RPM | 473 .32 RPM |
| SRP009831_lung | 0 .10 RPM | 367 .87 RPM |
| SRP009831_ovary | 0 .00 RPM | 251 .11 RPM |
| SRP009831_skeletal_muscle | 0 .00 RPM | 196 .97 RPM |