RetrogeneDB ID: | retro_ocun_1685 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL018763:543795..543993(-) | ||
| Located in intron of: | ENSOCUG00000008602 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ISCA1 | ||
| Ensembl ID: | ENSOCUG00000010945 | ||
| Aliases: | None | ||
| Description: | iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28660] |
| Percent Identity: | 57.35 % |
| Parental protein coverage: | 51.16 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | LVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPE-HVGVKVGVRTR-GCNGLSYTLEYTKTK |
| .V.A.V.AV..RKLQP..A....TPSAV.KIK.L..DKPE...GVKVGV.TR....G.S.TLEY.K.. | |
| Retrocopy | VV*AIVQAVNERKLQPSLATGAVTPSAVVKIKELPRDKPE>RAGVKVGVGTR<APYGVS*TLEYLKRR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 2 .15 RPM | 41 .72 RPM |
| SRP017611_kidney | 0 .10 RPM | 41 .05 RPM |
| SRP017611_liver | 0 .08 RPM | 10 .56 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046526 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001940 | 6 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000010652 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000016537 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007518 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000003559 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044792 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000010945 | 1 retrocopy |
retro_ocun_1685 ,
|
| Pongo abelii | ENSPPYG00000019339 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018343 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012826 | 2 retrocopies |