RetrogeneDB ID: | retro_ocun_1155 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 3:9971726..9971941(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOCUG00000022970 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.27 % |
| Parental protein coverage: | 56.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | YQQRVEDVRLIREQHPTK-IPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFL |
| .QQR..DV.LI.EQ.PTK..PV...R.KGEKQ.P.LDK.KFLVPDHVNMSELIK..RR.LQLNA.QA.FL | |
| Retrocopy | FQQR-GDVQLIQEQYPTK<VPVVTGRNKGEKQPPTLDKSKFLVPDHVNMSELIKTNRRCLQLNARQAIFL |
| Parental | LVNG |
| .V.G | |
| Retrocopy | FVKG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 48 .51 RPM |
| SRP017611_kidney | 0 .00 RPM | 53 .72 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .96 RPM |