RetrogeneDB ID: | retro_ocun_697 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 14:58463490..58463717(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GABARAPL1 | ||
| Ensembl ID: | ENSOCUG00000016834 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein like 1 [Source:HGNC Symbol;Acc:4068] |
| Percent Identity: | 55.7 % |
| Parental protein coverage: | 64.46 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | RVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAY |
| R.PDLDK...L.P.DLTV..F.FL..KRI.LRP...L........PP.SA.MG.LY.D..EE.Y.LYVAY | |
| Retrocopy | RAPDLDKKSHLGPFDLTVCHFFFLTQKRILLRP*EYLILQCQH--PPASASMGHLYVDSSEEGYLLYVAY |
| Parental | -SDESVYGK |
| ...E.VYGK | |
| Retrocopy | <CNENVYGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 174 .78 RPM |
| SRP017611_kidney | 0 .00 RPM | 234 .13 RPM |
| SRP017611_liver | 0 .00 RPM | 56 .26 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001218 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006718 | 1 retrocopy | |
| Homo sapiens | ENSG00000139112 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002197 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016834 | 3 retrocopies |
retro_ocun_1380, retro_ocun_496, retro_ocun_697 ,
|
| Oryctolagus cuniculus | ENSOCUG00000022970 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007434 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002246 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005307 | 19 retrocopies |
retro_tsyr_1045, retro_tsyr_1070, retro_tsyr_1101, retro_tsyr_1137, retro_tsyr_1308, retro_tsyr_1413, retro_tsyr_1467, retro_tsyr_1481, retro_tsyr_1671, retro_tsyr_1765, retro_tsyr_1800, retro_tsyr_234, retro_tsyr_573, retro_tsyr_761, retro_tsyr_796, retro_tsyr_832, retro_tsyr_864, retro_tsyr_978, retro_tsyr_999,
|
| Tursiops truncatus | ENSTTRG00000009099 | 3 retrocopies |