RetrogeneDB ID: | retro_sscr_188 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:209761490..209761720(-) | ||
| Located in intron of: | ENSSSCG00000025013 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MAP1LC3B | ||
| Ensembl ID: | ENSSSCG00000002655 | ||
| Aliases: | None | ||
| Description: | Sus scrofa microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), mRNA. [Source:RefSeq mRNA;Acc:NM_001190290] |
| Percent Identity: | 78.21 % |
| Parental protein coverage: | 61.6 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRR- |
| MP.EKTFKQR..FEQRVEDV.LI.EQHPTKI.VI.E.YKGEK.L.VLDKT.FLVPDHVNMSE.I.IIRR. | |
| Retrocopy | MPPEKTFKQRPAFEQRVEDVLLIQEQHPTKILVIVELYKGEKLLLVLDKTEFLVPDHVNMSEIIRIIRR< |
| Parental | RLQLNANQ |
| .L.LN.NQ | |
| Retrocopy | AL*LNTNQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 62 .78 RPM |
| SRP014902_testis | 0 .00 RPM | 44 .98 RPM |
| SRP018288_heart | 0 .00 RPM | 76 .17 RPM |
| SRP018288_kidney | 0 .00 RPM | 107 .27 RPM |
| SRP018288_liver | 0 .00 RPM | 99 .46 RPM |
| SRP018288_lung | 0 .00 RPM | 48 .88 RPM |
| SRP018856_adipose | 0 .00 RPM | 96 .21 RPM |
| SRP035408_brain | 0 .00 RPM | 81 .15 RPM |
| SRP035408_liver | 0 .00 RPM | 58 .07 RPM |