RetrogeneDB ID: | retro_nleu_1098 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397281.1:28020915..28021150(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CKS1B | ||
| Ensembl ID: | ENSNLEG00000011532 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 90.12 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIA-KLVPKTHLMSESE-WRNLGVQQSQGWVHYMIHEPEPHILL |
| MSHK.IYYSDKYDDEEFEYRHVMLPKDIA..LVP.THLMSESE..RNLGVQQSQGWVHY.IHEPEPHILL | |
| Retrocopy | MSHKKIYYSDKYDDEEFEYRHVMLPKDIA<QLVPETHLMSESE<MRNLGVQQSQGWVHYTIHEPEPHILL |
| Parental | FRRPLPKKPKK |
| .RRPLPKKPKK | |
| Retrocopy | CRRPLPKKPKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000033635 | 10 retrocopies | |
| Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
| Equus caballus | ENSECAG00000003460 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000003337 | 4 retrocopies | |
| Felis catus | ENSFCAG00000001347 | 1 retrocopy | |
| Homo sapiens | ENSG00000173207 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013419 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000032213 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028044 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008729 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011532 | 3 retrocopies |
retro_nleu_1098 , retro_nleu_2592, retro_nleu_411,
|
| Oryctolagus cuniculus | ENSOCUG00000016204 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
| Pongo abelii | ENSPPYG00000000768 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000001398 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000012383 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000029737 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000012182 | 1 retrocopy |