RetrogeneDB ID: | retro_ptro_3100 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | X:30825759..30825996(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CKS1B | ||
| Ensembl ID: | ENSPTRG00000001398 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes cyclin-dependent kinases regulatory subunit 1 (CKS1B), mRNA. [Source:RefSeq mRNA;Acc:NM_001252546] |
| Percent Identity: | 92.41 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
| M.HKQIYYSDKYDDEEFEY.HV.LPKD.AKLVPKTHLMSESEWRNLG.QQSQGWVHYMIHEPEPHILLF. | |
| Retrocopy | MLHKQIYYSDKYDDEEFEYQHVILPKDKAKLVPKTHLMSESEWRNLGIQQSQGWVHYMIHEPEPHILLFW |
| Parental | RPLPKKPKK |
| RPLPKKPKK | |
| Retrocopy | RPLPKKPKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .65 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .23 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .16 RPM |
| SRP007412_liver | 0 .03 RPM | 14 .44 RPM |
| SRP007412_testis | 0 .00 RPM | 15 .70 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_10 |
| Pongo abelii | retro_pabe_3625 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
| Equus caballus | ENSECAG00000003460 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000003337 | 4 retrocopies | |
| Felis catus | ENSFCAG00000001347 | 1 retrocopy | |
| Homo sapiens | ENSG00000173207 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000032213 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028044 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011532 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016204 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
| Pongo abelii | ENSPPYG00000000768 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000001398 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000012383 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000029737 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000012182 | 1 retrocopy |