RetrogeneDB ID: | retro_cjac_2040 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 21:19168261..19168494(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000033635 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.25 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKT-HLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLF |
| .S.KQ.YYS.KY....FEY.HVMLPKD.AKLVPKT.HL.SESEWRNLG.QQSQGWVHYMI..PEPHILLF | |
| Retrocopy | ISRKQTYYSNKYN-KQFEYWHVMLPKDLAKLVPKT<HLISESEWRNLGIQQSQGWVHYMIQKPEPHILLF |
| Parental | RRPLPKKPKK |
| ..PL.KKP.K | |
| Retrocopy | SCPLTKKPRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 5 .79 RPM |
| SRP051959_heart | 0 .05 RPM | 2 .19 RPM |
| SRP051959_kidney | 0 .09 RPM | 1 .73 RPM |
| SRP051959_liver | 0 .02 RPM | 3 .44 RPM |
| SRP051959_lung | 0 .02 RPM | 1 .64 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 2 .42 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .50 RPM |
| SRP051959_spleen | 0 .06 RPM | 4 .92 RPM |