RetrogeneDB ID: | retro_mmus_639 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 10:43373486..43373918(-) | ||
| Located in intron of: | ENSMUSG00000038240 | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000089839 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rps19 | ||
| Ensembl ID: | ENSMUSG00000040952 | ||
| Aliases: | Rps19, Dsk3 | ||
| Description: | ribosomal protein S19 [Source:MGI Symbol;Acc:MGI:1333780] |
| Percent Identity: | 80.27 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHK-ELAPYDENWFYTRAASTARHLYLRGG |
| MPGVTVKDVNQQEFV.ALAAFLKK..KLKVP.W.DTVKLAKHK..LAPYDE...YT.AA.TARHLYLRGG | |
| Retrocopy | MPGVTVKDVNQQEFVKALAAFLKKFRKLKVPKWGDTVKLAKHK<KLAPYDEL*SYTPAAFTARHLYLRGG |
| Parental | AGVGSMTKIYGGRQRNGVRPSHFS-RGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQV |
| AGVGSMTKIYGG..R.GVRPSHFS.RGSKSVARR.LQALEGLKMVEKD.DG.........RDLDRI.GQV | |
| Retrocopy | AGVGSMTKIYGGW*RYGVRPSHFS>RGSKSVARRDLQALEGLKMVEKD*DGATSYHLR-DRDLDRITGQV |
| Parental | AAANKKH |
| AA.NKKH | |
| Retrocopy | AAVNKKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 27 .33 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .38 RPM |
| SRP007412_heart | 0 .00 RPM | 33 .18 RPM |
| SRP007412_kidney | 0 .04 RPM | 20 .48 RPM |
| SRP007412_liver | 0 .00 RPM | 25 .26 RPM |
| SRP007412_testis | 0 .00 RPM | 11 .30 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_3389 | 207 libraries | 373 libraries | 413 libraries | 64 libraries | 15 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000028485 | 10 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020243 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000002376 | 4 retrocopies | |
| Equus caballus | ENSECAG00000009738 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013429 | 8 retrocopies | |
| Monodelphis domestica | ENSMODG00000010067 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007164 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000040952 | 15 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026255 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000048199 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000003042 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003502 | 3 retrocopies |