RetrogeneDB ID: | retro_mmul_691 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1099214726765:5617..6052(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMMUG00000003630 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.9721 | ||
| Ensembl ID: | ENSMMUG00000013429 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 94.48 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGA |
| MPGVTVKD.NQQEFVRALA.FLKKS.KLKVPEWVDTVKLAKHKELAP.DENWFYTRAASTARHLYLRGGA | |
| Retrocopy | MPGVTVKDMNQQEFVRALATFLKKSRKLKVPEWVDTVKLAKHKELAPHDENWFYTRAASTARHLYLRGGA |
| Parental | GVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAA |
| GVGSMTKIYGGRQRNGV.PSH.S.GSKSVAR.VLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAA | |
| Retrocopy | GVGSMTKIYGGRQRNGVTPSHVSQGSKSVARLVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAA |
| Parental | ANKKH |
| ANKKH | |
| Retrocopy | ANKKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 7 .28 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .24 RPM | 25 .46 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 3 .68 RPM |
| SRP007412_heart | 0 .82 RPM | 25 .50 RPM |
| SRP007412_kidney | 0 .70 RPM | 7 .86 RPM |
| SRP007412_liver | 1 .23 RPM | 26 .72 RPM |
| SRP007412_testis | 0 .60 RPM | 27 .86 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000028485 | 10 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020243 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000002376 | 4 retrocopies | |
| Equus caballus | ENSECAG00000009738 | 2 retrocopies | |
| Homo sapiens | ENSG00000105372 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000004554 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013429 | 8 retrocopies |
retro_mmul_1201, retro_mmul_1358, retro_mmul_1807, retro_mmul_2007, retro_mmul_2443, retro_mmul_404, retro_mmul_607, retro_mmul_691 ,
|
| Monodelphis domestica | ENSMODG00000010067 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007164 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000040952 | 15 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026255 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000048199 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000003042 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003502 | 3 retrocopies |