RetrogeneDB ID: | retro_mmus_522 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 10:3992370..3992814(+) | ||
| Located in intron of: | ENSMUSG00000040675 | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000082247 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rnf4 | ||
| Ensembl ID: | ENSMUSG00000029110 | ||
| Aliases: | Rnf4, AU018689, Gtrgeo8 | ||
| Description: | ring finger protein 4 [Source:MGI Symbol;Acc:MGI:1201691] |
| Percent Identity: | 86.84 % |
| Parental protein coverage: | 78.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVETVGDEIVDLTCESLEPVVVDLTHNDS |
| M.TRNPQRKRRG...NSRQTQKRTRETTSTPEV.LETEPIEL.ETVGDEIVDL.C.SLEPVVVDLTHNDS | |
| Retrocopy | MRTRNPQRKRRGAALNSRQTQKRTRETTSTPEVALETEPIELMETVGDEIVDLACKSLEPVVVDLTHNDS |
| Parental | VVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSRDKDVYVTTHTPRSTKDDGATGPRPSGTVSCPICM |
| .VIVEERR....NGRRLRQDHADSCVVSSDDEELSRDKD.YVTTHTPR.TKDDGA.GPR.SGT..CPICM | |
| Retrocopy | AVIVEERR----NGRRLRQDHADSCVVSSDDEELSRDKDMYVTTHTPRNTKDDGAPGPRRSGTLRCPICM |
| Parental | DGYSEIVQNGRL |
| DGYSEIV.NGRL | |
| Retrocopy | DGYSEIV*NGRL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 70 .42 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 67 .30 RPM |
| SRP007412_heart | 0 .09 RPM | 31 .66 RPM |
| SRP007412_kidney | 0 .04 RPM | 60 .73 RPM |
| SRP007412_liver | 0 .08 RPM | 83 .51 RPM |
| SRP007412_testis | 0 .32 RPM | 166 .49 RPM |
| ENCODE library ID | Target | ChIP-Seq Peak coordinates |
|---|---|---|
| ENCFF001YKA | POLR2A | 10:3991155..3992403 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014366 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000014856 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024877 | 1 retrocopy | |
| Homo sapiens | ENSG00000063978 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015149 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000007382 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001767 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000029110 | 1 retrocopy |
retro_mmus_522 ,
|
| Nomascus leucogenys | ENSNLEG00000000160 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000004998 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000010776 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025865 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000017017 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011101 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011244 | 1 retrocopy |